- OR4K1 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-86374
- Human
- OR14-19
- 0.1 ml (also 25ul)
- Rabbit
- PBS (pH 7.2) and 40% Glycerol
- This antibody was developed against Recombinant Protein corresponding to amino acids: TVDLPFCGPN EVDSFFCDLP LVIELACMDT YEMEIMTLTN
- Immunohistochemistry, Immunohistochemistry-Paraffin
- Unconjugated
- OR4K1
- olfactory receptor family 4 subfamily K member 1
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
TVDLPFCGPNEVDSFFCDLPLVIELACMDTYEMEIMTLTN
Specifications/Features
Available conjugates: Unconjugated